Cat: PA2000-1029

Recombinant Human CCK18 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CCK18

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CCK18;Cholecystokinin

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P06307

  • Expression Region

    46-103aa

  • AA Sequence

    VSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF

  • Molecular Weight

    12.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CCK18, or cholecystokinin-18, is a neuropeptide that plays a crucial role in digestion and satiety regulation, impacting various physiological processes such as appetite control, gallbladder contraction, and pancreatic enzyme secretion. The significance of CCK18 has spurred research aimed at understanding its structure, function, and potential therapeutic applications. As a member of the cholecystokinin family, CCK18 is known to interact with specific receptors in the gastrointestinal system, influencing both central and peripheral pathways involved in energy homeostasis. Recent advances in recombinant protein technology have allowed for the efficient production of CCK18, facilitating detailed studies of its biological activity and receptor interactions. Investigating the recombinant form of CCK18 enables researchers to explore its role in signaling pathways and its implications for diseases related to metabolism, obesity, and gastrointestinal disorders. Furthermore, the study of CCK18 has opened new avenues for drug development, where modulating its activity could offer innovative strategies for treating metabolic syndrome and related conditions. The combination of biotechnology and pharmacology in this context represents a promising frontier in health sciences, underscoring the importance of CCK18 in both fundamental research and potential clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US