Cat: PA1000-2632

Recombinant Human RAB5B Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RAB5B

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RAB5B;Ras-related Protein Rab-5B

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P61020

  • Expression Region

    1-215aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMTSRSTARPNGQPQASKICQFKLVLLG ESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTA GQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIV IALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAI AKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN

  • Molecular Weight

    26 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RAB5B is a member of the RAB family of small GTPases that plays a critical role in the regulation of endocytic pathways, actin cytoskeleton dynamics, and signal transduction processes. It primarily functions in the early stages of endocytosis, where it facilitates the fusion of early endosomes and contributes to the maturation of these organelles. Understanding the structure and function of RAB5B is essential in elucidating its involvement in various cellular processes, including nutrient uptake, receptor recycling, and pathogen entry. Recently, research has indicated that dysregulation of RAB5B is associated with several diseases, including cancer and neurodegenerative disorders, highlighting its potential as a therapeutic target. The production of RAB5B recombinant protein allows for in-depth studies of its biochemical properties, interaction partners, and role in cellular signaling pathways. Further characterization of RAB5B through recombinant techniques can provide valuable insights into its functional mechanisms and implications in health and disease, paving the way for developing novel therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US