Analytical Data
-
Gene name
Rab5a
- Application
-
Alternative Names
RAB5A;RAB5;Ras-related Protein Rab-5A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P20339
-
Expression Region
1-215aa
-
AA Sequence
MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
-
Molecular Weight
39.7kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Rab5a is a member of the Rab GTPase family, which plays a crucial role in regulating membrane trafficking and endocytic pathways in eukaryotic cells. Research into Rab5a has gained momentum due to its significant involvement in various cellular processes, including early endosome formation, fusion, and the regulation of endocytosis. Dysregulation of Rab5a has been linked to several diseases, including neurodegenerative disorders and cancer, highlighting its potential as a therapeutic target. The study of Rab5a recombinant proteins is essential for understanding its functional mechanisms and interactions within cellular pathways. By generating and characterizing these proteins, researchers can elucidate the molecular dynamics of Rab5a in endosome maturation and its influence on signaling pathways. Furthermore, the exploration of Rab5a's interactions with other proteins and its role in the cellular context may provide insights into the development of novel therapeutic strategies to modulate its activity in disease states. Given the increasing interest in membrane trafficking and cellular homeostasis, Rab5a remains a prominent focal point in cell biology research, underscoring the importance of recombinant protein studies in this domain.
