Cat: PA1000-2618

Recombinant Human RAB27B Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RAB27B

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    RAB27B;Ras-related Protein Rab-27B

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00194

  • Expression Region

    1-218aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMTDGDYDYLIKLLALGDSGVGKTTFLYRYT DNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQER FRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVL IGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDL IMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC

  • Molecular Weight

    27 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RAB27B is a member of the RAB family of small GTPases, which are pivotal in regulating intracellular transport processes, particularly in the exocytosis of secretory granules. This protein plays a crucial role in various cellular functions, including the secretion of hormones, neurotransmitters, and various biomolecules. Studies have shown that RAB27B is essential for the proper function of immune cells, such as mast cells and cytotoxic T lymphocytes, where it governs the release of inflammatory mediators and cytotoxic granules. Mutations or dysregulation of RAB27B have been linked to various diseases, including immunological disorders and cancer, highlighting its potential as a therapeutic target. The recombinant expression and functional characterization of RAB27B allow researchers to better understand its role in cellular mechanisms and its implications in disease pathology. The availability of RAB27B protein in a recombinant form facilitates structural studies and the identification of interacting partners, paving the way for the development of targeted therapies aimed at modulating its activity in diseases where its function is compromised. Overall, the exploration of RAB27B as a research subject holds promise for uncovering novel insights into intracellular trafficking and enhancing our understanding of related pathophysiological processes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US