Analytical Data
-
Gene name
MTMR3
- Application
-
Alternative Names
FYVE domain-containing dual specificity protein phosphatase 1; FYVE-DSP1; ; _HUMAN; Myotubularin-related protein 3; Zinc finger FYVE domain-containing protein 10
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13615
-
Expression Region
579-674 aa
-
AA Sequence
CPSPTTPVDDSCAPYPAPGTSPDDPPLSRLPKTRSYDNLTTACDNTVPLASRRCSDPSLNEKWQEHRRSLELSSLAGPGEDPLSADSLGKPTRVPG
-
Molecular Weight
36.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MTMR3 (Myotubularin-related protein 3) is a member of the myotubularin family of lipid phosphatases, which are involved in cellular processes such as phosphoinositide metabolism and endosomal trafficking. Research on MTMR3 has garnered attention due to its association with various cellular functions that are crucial for muscle development and function. Mutations in the MTMR3 gene have been linked to Charcot-Marie-Tooth disease, a hereditary neuropathy that affects peripheral nerves, highlighting the importance of this protein in neurological health. Additionally, MTMR3 is speculated to play a role in lipid homeostasis and autophagy, making it a potential target for understanding and treating metabolic and neurodegenerative disorders. The recombinant expression of MTMR3 protein allows for detailed biochemical assays to elucidate its enzymatic activity, substrate specificity, and interactions with other cellular components. Exploring the structure-function relationship of MTMR3 through recombinant technology can provide insights into the pathogenic mechanisms underlying related diseases and may open avenues for novel therapeutic strategies aimed at mitigating the effects of MTMR3 deficiencies. Therefore, the study of MTMR3 not only contributes to basic biological knowledge but also has promising implications for clinical research in neuromuscular and metabolic disorders.
