Analytical Data
-
Gene name
PURB
- Application
-
Alternative Names
PURB;Transcriptional regulator Protein Pur-beta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96QR8
-
Expression Region
1-312aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMADGDSGSERGGGGGPCGFQPASRGGG EQETQELASKRLDIQNKRFYLDVKQNAKGRFLKIAEVGAGGSKSRLTLSM AVAAEFRDSLGDFIEHYAQLGPSSPEQLAAGAEEGGGPRRALKSEFLVRE NRKYYLDLKENQRGRFLRIRQTVNRGGGGFGAGPGPGGLQSGQTIALPAQ GLIEFRDALAKLIDDYGGEDDELAGGPGGGAGGPGGGLYGELPEGTSITV DSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYAD EMKEIQERQRDKLYERRGGGSGGGEESEGEEVDED
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PURB (PUF RNA-binding protein) is a member of the PUF family of RNA-binding proteins that plays a crucial role in post-transcriptional regulation of gene expression. It is widely implicated in various biological processes, including mRNA stability, translation, and localization in both prokaryotic and eukaryotic systems. The importance of PURB has been underscored by its involvement in cellular differentiation, development, and stress responses, as well as its contributions to maintaining cellular homeostasis. Recent studies have shown that PURB can interact with a variety of RNA molecules and proteins, indicating its potential as a key regulator in RNA metabolism. Given the multifaceted roles of PURB, understanding its structure, function, and mechanisms of action is vital for elucidating its contributions to various genetic disorders and diseases, including cancer and neurological disorders. As research continues to uncover the complexities of PURB's interactions, it presents promising opportunities for therapeutic interventions aimed at modulating its activity to restore normal cellular functions or to combat disease states. The exploration of PURB's role in gene regulation thus represents a significant frontier in molecular biology and therapeutic development.











