Analytical Data
-
Gene name
MS4A7
- Application
-
Alternative Names
MS4A7; 4SPAN2; CD20L4; CFFM4; Membrane-spanning 4-domains subfamily A member 7; CD20 antigen-like 4; CD20/FC-epsilon-RI-beta family member 4; Four-span transmembrane protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9GZW8
-
Expression Region
1-240 aa
-
AA Sequence
MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLIS SLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTS NAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVS LTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI
-
Molecular Weight
26.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MS4A7, a member of the MS4A (membrane-spanning 4-domain subfamily A) gene family, has garnered increasing attention in recent years due to its association with various biological processes and diseases. Initially implicated in immune system regulation, MS4A7 is expressed in several immune cells, suggesting a potential role in inflammatory responses. Research has also linked MS4A7 to certain neurodegenerative diseases, particularly Alzheimer's disease, where its expression levels may influence amyloid-beta metabolism. The understanding of MS4A7's function is further complicated by its polymorphisms, which have been associated with altered susceptibility to complex diseases, particularly in diverse populations. The recombinant expression of MS4A7 protein in various model systems is crucial for elucidating its structure-function relationships, facilitating the identification of its interaction partners, and exploring its potential as a therapeutic target. Advances in recombinant protein technology have enabled the production of MS4A7 in sufficient quantities for detailed biochemical and biophysical analysis, enhancing our understanding of its role in cellular signaling pathways and immune responses. This research has significant implications for both basic biology and translational medicine, particularly in developing strategies for modulating MS4A7 activity in disease contexts, thereby potentially therapeutic intervention in conditions where MS4A7 is implicated. As the body of knowledge around MS4A7 expands, it may reveal novel insights into disease mechanisms and underscore the importance of membrane proteins in health and disease.











