Analytical Data
-
Gene name
MS4A6A
- Application
-
Alternative Names
MS4A6A; 4SPAN3; CD20L3; MS4A6; CDA01; MSTP090; Membrane-spanning 4-domains subfamily A member 6A; CD20 antigen-like 3; Four-span transmembrane protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H2W1
-
Expression Region
1-248 aa
-
AA Sequence
MTSQPVPNETIIVLPSNVINFSQAEKPEPTNQGQDSLKKHLHAEIKVIGTIQILCGMMVL SLGIILASASFSPNFTQVTSTLLNSAYPFIGPFFFIISGSLSIATEKRLTKLLVHSSLVG SILSALSALVGFIILSVKQATLNPASLQCELDKNNIPTRSYVSYFYHDSLYTTDCYTAKA SLAGTLSLMLICTLLEFCLAVLTAVLRWKQAYSDFPGSVLFLPHSYIGNSGMSSKMTHDC GYEELLTS
-
Molecular Weight
26.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MS4A6A (Moloney Sarcoma Viral Oncogene Homolog A6A) is a member of the MS4A gene family, which encodes a group of membrane-spanning proteins primarily expressed in immune cells. Research has suggested that MS4A6A plays a significant role in immune responses, particularly in the regulation of B-cell activation and differentiation. The protein has garnered attention in the context of various diseases, including autoimmune disorders and different types of cancer, where its expression patterns may influence disease progression and prognosis. The study of recombinant MS4A6A proteins has opened avenues for understanding its functional mechanisms and interactions with other cellular components. By generating and characterizing these recombinant proteins, researchers aim to elucidate the underlying biological processes that MS4A6A mediates, as well as its potential as a therapeutic target. Understanding the structure and function of MS4A6A may also contribute to the development of novel immunotherapies, making it a focal point in ongoing biomedical research efforts aimed at tackling immune-related diseases.
