Analytical Data
-
Gene name
PTRH2
- Application
-
Alternative Names
PTRH2;BIT1;PTH2;Peptidyl-tRNA hydrolase 2. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y3E5
-
Expression Region
64-179aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMEYKMILVVRNDLKMGKGKVAAQCSHAAVS AYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSL IQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY
-
Molecular Weight
15 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTRH2 (Perturbation of Transcriptionally Regulated Host 2) is a protein of significant interest in the field of molecular biology and biomedicine, primarily due to its role in regulating gene expression and its potential implications in various diseases, including cancer. Research has shown that PTRH2 is involved in cellular stress responses, especially in the context of oxidative stress and apoptosis. This protein functions as a molecular chaperone, assisting in the proper folding of proteins and protecting cells from damage induced by misfolded proteins. The study of PTRH2 is particularly relevant in understanding the mechanisms of tumorigenesis, as alterations in its expression levels have been linked to the progression of several malignancies. Furthermore, investigating its interactions with other cellular pathways can provide insights into therapeutic targets for cancer treatment and the development of novel strategies to enhance cellular resilience against stress. The challenges associated with producing recombinant PTRH2 proteins for experimental purposes include achieving high yields with proper functionality, necessitating the use of advanced techniques in recombinant DNA technology and protein purification. As researchers explore the multifaceted roles of PTRH2 in health and disease, understanding its structure and function could pave the way for new diagnostic and therapeutic approaches in treating diseases characterized by cellular stress responses.











