Analytical Data
-
Gene name
PSMB2
- Application
-
Alternative Names
PSMB2;Proteasome subunit beta type-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49721
-
Expression Region
1-201aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMEYLIGIQGPDYVLVASDRVAASNIVQMKD DHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAA ANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKR FILNLPTFSVRIIDKNGIHDLDNISFPKQGS
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PSMB2, or Proteasome Subunit Beta 2, is a crucial component of the 26S proteasome, a multi-subunit protease complex responsible for degrading ubiquitinated proteins and regulating various cellular processes, including the cell cycle, apoptosis, and antigen processing. Research into PSMB2 has gained momentum due to its integral role in protein homeostasis and implications in various diseases, including cancer, neurodegenerative disorders, and autoimmune conditions. Mutations or dysregulation of PSMB2 have been linked to altered proteasome activity, hence affecting cellular functions and contributing to pathophysiological conditions. Given its significance, PSMB2 is a promising target for therapeutic interventions aimed at modulating proteasome activity. Moreover, the study of recombinant PSMB2 protein has provided insights into its structure, function, and interactions with other proteasome components, enabling the development of potent proteasome inhibitors and enhancing our understanding of proteostasis mechanisms. Consequently, exploring PSMB2 at a molecular level could provide novel strategies for disease treatment and inform the design of drugs that selectively modulate proteasomal functions.
