Cat: PA2000-5271

Recombinant Human hcp1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    hcp1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    hcp1;G21;HCP1;PCFT;Proton-coupled folate transporter

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9I747

  • Expression Region

    24.9 kDa

  • AA Sequence

    MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGGGGAGKVNVQDLSFTKYIDKSTPNLMMACSSGKHYPQAKLTIRKAGGENQVEYLIITLKEVLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQKADGAKDGGPVKYGWNIRQNVQA

  • Molecular Weight

    24.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HCP1 (Human Copper Transporter 1) is a vital protein involved in the regulation of copper homeostasis in the body. Research on HCP1 has gained prominence due to the critical role copper plays in various biological processes, including enzymatic reactions, oxidative stress response, and mitochondrial function. Dysregulation of copper transport can lead to pathological conditions such as Wilson's disease and Menkes disease, both of which are associated with severe neurological and developmental issues. Understanding the molecular structure and function of HCP1 is essential for elucidating its role in copper metabolism and its implications in disease states. Recent advancements in recombinant protein technology have enabled the production of HCP1 in significant quantities, facilitating in-depth studies of its biochemical properties and interactions. The ability to characterize HCP1 using techniques such as X-ray crystallography and NMR spectroscopy will provide insights into its mechanism of action and potential as a therapeutic target. Additionally, the study of HCP1 may reveal new avenues for drug development aimed at correcting copper transport dysregulation, thus contributing to the treatment of related disorders. As research progresses, HCP1 is emerging as an important player in the field of molecular biology and medicine, underscoring the necessity for further exploration of its functions and therapeutic potential.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US