Cat: PA1000-2555

Recombinant Human PSMB10 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PSMB10

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PSMB10;LMP10;MECL1;Proteasome subunit beta type-10

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P40306

  • Expression Region

    40-237aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMTTIAGLVFQDGVILGADTRATNDSVVADK SCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATV TRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGS GQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVIT KTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQ AMEVE

  • Molecular Weight

    27 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PSMB10, also known as the beta-10 subunit of the proteasome, plays a crucial role in the ubiquitin-proteasome system (UPS), which is essential for regulating protein degradation and maintaining cellular homeostasis. The proteasome is a large proteolytic complex that degrades polyubiquitinated proteins, thus controlling various cellular processes, including the cell cycle, apoptosis, and immune responses. Research has shown that PSMB10 is not only involved in protein turnover but also in the processing of major histocompatibility complex (MHC) class I molecules, thereby influencing antigen presentation and immune response. Dysregulation of PSMB10 has been associated with several diseases, including cancer, autoimmune disorders, and neurodegenerative conditions, making it a significant target for therapeutic interventions. Recent studies have focused on the expression and functionality of recombinant PSMB10 proteins, particularly in studying their dynamics in disease models and exploring their potential as biomarkers or therapeutic targets. Understanding the structural and functional properties of PSMB10 can provide deeper insights into its role in disease pathology and open new avenues for targeted therapies aimed at modulating proteasomal activity and enhancing cellular health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US