Analytical Data
-
Gene name
PSMB1
- Application
-
Alternative Names
PSMB1;PSC5;Proteasome subunit beta type-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P20618
-
Expression Region
29-241aa
-
AA Sequence
RFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD
-
Molecular Weight
50.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PSMB1, or Proteasome Subunit Beta Type-1, is a critical component of the 26S proteasome, which plays a pivotal role in the degradation of ubiquitinated proteins, thereby regulating various cellular processes including cell cycle progression, signal transduction, and the response to oxidative stress. Research into PSMB1 has gained momentum due to its involvement in the immune response and its potential implications in various diseases, including cancer and neurodegenerative disorders. Mutations or dysregulation of PSMB1 can lead to impaired proteasome activity, resulting in the accumulation of damaged proteins and contributing to pathologies. Recombinant PSMB1 proteins have been studied to better understand their structure-function relationship and to develop therapeutic strategies aimed at modulating proteasome function. Additionally, PSMB1 is of interest in the field of biomarker discovery, as its expression levels can indicate disease states or responses to therapy. The study of PSMB1 is therefore not only integral to understanding fundamental cellular processes but also holds promise for the development of new diagnostic and therapeutic approaches in precision medicine. Advances in recombinant DNA technology have facilitated the production and characterization of PSMB1, enabling researchers to explore its potential in drug discovery and the design of proteasome inhibitors with selective activity.











