Analytical Data
-
Gene name
Trap1
- Application
-
Alternative Names
Trap1；HSP75；HSPC5；Heat shock Protein 75 kDa. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q12931
-
Expression Region
60-308aa
-
AA Sequence
STQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWMMDPKDVRE
-
Molecular Weight
54.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Trap1 (TNF receptor-associated protein 1) is a key cytosolic protein that plays a critical role in various cellular processes, including cell signaling, apoptosis, and mitochondrial function. It has garnered attention in recent years due to its involvement in the regulation of heat shock protein 90 (HSP90) and its impact on protein homeostasis. Research indicates that Trap1 can modulate mitochondrial metabolism and reactive oxygen species (ROS) production, linking it to stress responses and potential neuroprotective roles. Abnormalities in Trap1 expression or function have been associated with several diseases, including cancer and neurodegenerative disorders, making it a compelling target for therapeutic intervention. The development of recombinant Trap1 proteins has facilitated the exploration of its functional mechanisms, aiding in the elucidation of its role in cellular stress responses and disease pathology. Furthermore, studying Trap1's interactions with other cellular proteins offers insights into its regulatory networks, potentially leading to novel strategies for disease treatment and prevention. Overall, Trap1's multifunctionality and association with critical biological processes underscore its significance in both basic research and clinical applications.
