Analytical Data
-
Gene name
SLC35F3
- Application
-
Alternative Names
SLC35F3;Solute carrier family 35 member F3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IY50
-
Expression Region
1-421aa
-
AA Sequence
MKKHSARVAPLSACNSPVLTLTKVEGEERPRDSPGPAEAQAPAGVEAGGRASRRCWTCSRAQLKKIFWGVAVVLCVCSSWAGSTQLAKLTFRKFDAPFTLTWFATNWNFLFFPLYYVGHVCKSTEKQSVKQRYRECCRFFGDNGLTLKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDVSVLFCCNKAFVFLLSWIVLRDRFMGVRIVAAILAIAGIVMMTYADGFHSHSVIGIALVVASASMSALYKVLFKLLLGSAKFGEAALFLSILGVFNILFITCIPIILYFTKVEYWSSFDDIPWGNLCGFSVLLLTFNIVLNFGIAVTYPTLMSLGIVLSIPVNAVIDHYTSQIVFNGVRVIAIIIIGLGFLLLLLPEEWDVWLIKLLTRLKVRKKEEPAEGAADLSSGPQSKNRRARPSFAR
-
Molecular Weight
46.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC35F3 is a member of the SLC (Solute Carrier) family, which encompasses various transport proteins responsible for the movement of a wide range of substrates across cellular membranes. Research into SLC35F3 has gained attention due to its potential role in cellular processes related to nucleotide transport and metabolism, as well as its implications in health and disease. Studies indicate that SLC35F3 may be involved in the transport of nucleotide sugars, which are essential for glycosylation processes critical for cell signaling and structural integrity. Dysregulation of SLC35F3 may be linked to various pathological conditions, including metabolic disorders and cancer. Furthermore, understanding the structure-function relationship of SLC35F3 and its interaction with other cellular components can provide insights into its physiological roles and applications in therapeutic strategies. The investigation of SLC35F3 as a recombinant protein has become instrumental in elucidating its functionality and potential as a biomarker or target for drug development. Researchers are utilizing advanced techniques, including gene editing and protein expression systems, to produce and study SLC35F3 in detail, aiming to uncover its mechanisms of action and contribution to cellular homeostasis. This knowledge may pave the way for innovative approaches to manipulate its activity in clinical settings, highlighting the importance of ongoing research in understanding this enigmatic transporter.











