Analytical Data
-
Gene name
Rep78
- Application
-
Alternative Names
Rep78；BTB/POZ domain-containing Protein KCTD5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NXV2
-
Expression Region
1-234aa
-
AA Sequence
MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTASEPSEKAKILQERGSRM
-
Molecular Weight
26kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Rep78 protein, derived from the adeno-associated virus type 2 (AAV2), plays a crucial role in the virus's life cycle and is essential for its replication and gene expression. This protein, encoded by the rep gene, is responsible for the regulation of viral replication, encapsidation, and the transition of the viral lifecycle. Research into Rep78 has gained interest due to its potential applications in gene therapy and biotechnology, particularly as a tool for delivering therapeutic genes to target cells. The AAVs, being non-pathogenic and capable of infecting both dividing and non-dividing cells, make Rep78 an appealing candidate for developing novel gene delivery systems. Studies have shown that modulating Rep78 expression and function can enhance the efficiency of AAV vectors, improving their effectiveness in therapeutic applications. Furthermore, understanding the molecular mechanisms that govern Rep78's function could lead to insights into viral behavior and the development of strategies to harness or inhibit viral processes for therapeutic benefits. Thus, the ongoing research into Rep78 not only deepens our understanding of AAV biology but also paves the way for innovative advancements in gene therapy and regenerative medicine.
