Analytical Data
-
Gene name
PSMA3
- Application
-
Alternative Names
PSMA3;HC8;PSC8;Proteasome subunit alpha type-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P25788
-
Expression Region
1-255aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSSIGTGYDLSASTFSPDGRVFQVEYAMKA VENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAG LLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVR PFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKL QMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPK DIREEAEKYAKESLKEEDESDDDNM
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PSMA3, or Proteasome Subunit Beta 3, is a critical component of the 26S proteasome, the cellular complex responsible for degrading ubiquitinated proteins, thereby maintaining protein homeostasis and regulating various cellular processes such as cell cycle, apoptosis, and stress responses. Research into PSMA3 has gained momentum due to its involvement in several diseases, most notably cancer, where dysregulation of proteasomal activity can lead to abnormal cell proliferation and survival. Additionally, PSMA3 has been linked to neurodegenerative disorders, as the accumulation of misfolded proteins is a hallmark of conditions like Alzheimer’s disease. Understanding the structure and function of PSMA3 can provide insights into therapeutic strategies targeting the proteasome for cancer treatment and neuroprotection. Recent advancements in recombinant protein technology have facilitated the expression and purification of PSMA3, enabling detailed biochemical and biophysical analyses. Investigating PSMA3 through these methods can uncover its specific roles in proteasomal function and its interactions with other proteasome components and substrates. This research is crucial for developing novel inhibitors or modulators that can restore normal proteasomal function in diseased states, potentially leading to innovative approaches in targeted therapies. Overall, PSMA3 stands out as a promising target in the realm of proteasome research, with significant implications for understanding disease mechanisms and identifying new treatment paradigms.
