Analytical Data
-
Gene name
PPARGC1B
- Application
-
Alternative Names
PPARGC1B；PERC；PGC1；PGC1B；Peroxisome proliferator-activated receptor gamma coactivator 1-beta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86YN6
-
Expression Region
868-1023aa
-
AA Sequence
TRRNFRCESRGPCSDRTPSIRHARKRREKAIGEGRVVYIQNLSSDMSSRELKRRFEVFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH
-
Molecular Weight
25.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPARGC1B, also known as PGC-1β, is a critical transcriptional coactivator that plays a pivotal role in regulating energy metabolism, mitochondrial biogenesis, and adaptive thermogenesis. First identified in the context of brown adipose tissue, PPARGC1B is known to interact with various nuclear receptors and transcription factors, influencing the expression of genes involved in oxidative metabolism and muscle differentiation. Recent studies have underscored its significance in metabolic disorders, obesity, and muscle-related diseases, suggesting that modulating its activity could offer therapeutic potential. Additionally, the functional characterization of PPARGC1B through recombinant protein studies has provided insights into its mechanistic pathways and regulatory networks. Understanding the structural and functional properties of PPARGC1B is crucial for elucidating its role in metabolic regulation and identifying potential drug targets for interventions in metabolic syndromes. The ongoing research into this protein is not only important for understanding fundamental biological processes but also for developing innovative strategies to combat metabolic diseases and enhance muscle health.
