Analytical Data
-
Gene name
BTNL3
- Application
-
Alternative Names
BTNL3；BTNLR；COLF4100；Butyrophilin-like Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UXE8
-
Expression Region
1-466aa
-
AA Sequence
MAFVLILVLSFYELVSGQWQVTGPGKFVQALVGEDAVFSCSLFPETSAEAMEVRFFRNQFHAVVHLYRDGEDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQIYDEEATWELRVAALGSLPLISIVGYVDGGIQLLCLSSGWFPQPTAKWKGPQGQDLSSDSRANADGYSLYDVEISIIVQENAGSILCSIHLAEQSHEVESKVLIGETFFQPSPWRLASILLGLLCGALCGVVMGMIIVFFKSKGKIQAELDWRRKHGQAELRDARKHAVEVTLDPETAHPKLCVSDLKTVTHRKAPQEVPHSEKRFTRKSVVASQGFQAGKHYWEVDVGQNVGWYVGVCRDDVDRGKNNVTLSPNNGYWVLRLTTEHLYFTFNPHFISLPPSTPPTRVGVFLDYEGGTISFFNTNDQSLIYTLLTCQFEGLLRPYIQHAMYDEEKGTPIFICPVSWG
-
Molecular Weight
52kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BTNL3 (butyrophilin-like 3) is a member of the butyrophilin family, which plays a significant role in the immune system, particularly in the regulation of T cell responses. Research has shown that BTNL3 is involved in the modulation of T cell activation and tolerance, influencing the outcomes of autoimmune diseases and cancer. Studies suggest that BTNL3 might have potential implications in the differentiation and function of regulatory T cells (Tregs), thereby affecting immune responses. Given its regulatory functions, BTNL3 has emerged as a potential target for novel therapeutic strategies aimed at enhancing immune responses against tumors or dampening harmful autoimmune responses. The recombinant expression of BTNL3 has been a focal point for researchers aiming to explore its molecular mechanisms, functional characteristics, and possible applications in immunotherapy. Understanding BTNL3's structure and function through recombinant protein studies could lead to insights into its role in immune regulation and pave the way for its use in clinical settings, particularly in developing targeted therapies for diseases characterized by dysregulated immune responses.
