Analytical Data
-
Gene name
PSG5
- Application
-
Alternative Names
PSG5;Pregnancy-specific beta-1-glycoProtein 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15238
-
Expression Region
35-335aa
-
AA Sequence
QVTIEALPPKVSEGKDVLLLVHNLPQNLAGYIWYKGQLMDLYHYITSYVV DGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSYTLHIIKRGDRTRGV TGYFTFNLYLKLPKPYITINNSKPRENKDVLAFTCEPKSENYTYIWWLNG QSLPVSPRVKQPIENRILILPSVTRNETGPYECEIRDRDGGMHSDPVTLN VLYGPDLPSIYPSFTYYRSGENLYLSCFAESNPPAEYFWTINGKFQQSGQ KLSIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNP IVDHHHHHH
-
Molecular Weight
35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PSG5, or Pregnancy-specific Glycoprotein 5, is a member of the PSG family, which is primarily expressed in the placenta and plays a crucial role in pregnancy maintenance and fetal development. The PSG proteins, including PSG5, are associated with immunomodulatory functions, helping to create an environment conducive to fetal growth and protecting the developing fetus from maternal immune rejection. Research into PSG5 has gained momentum due to its potential implications in reproductive health, pregnancy disorders, and its possible roles in cancer biology. Studies indicate that PSG5 may regulate various immune responses and influence trophoblast cell behavior, making it a candidate for investigations into placenta-related pathologies such as preeclampsia and gestational diabetes. Additionally, PSG5's unique structural characteristics and functional properties warrant further exploration to understand its mechanisms at the molecular level. Advances in recombinant protein technology have facilitated the production of PSG5 for in vitro studies, enabling researchers to dissect its interactions with immune cells and other signaling pathways. This ongoing research aims to clarify PSG5's role in both healthy and pathological pregnancy conditions, potentially leading to novel therapeutic strategies to address issues related to reproduction and placental health.
