Analytical Data
-
Gene name
SLC44A4
- Application
-
Alternative Names
SLC44A4;C6orf29;CTL4;NG22;Choline transporter-like Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q53GD3
-
Expression Region
56-229aa
-
AA Sequence
WLYGDPRQVLYPRNSTGAYCGMGENKDKPYLLYFNIFSCILSSNIISVAENGLQCPTPQVCVSSCPEDPWTVGKNEFSQTVGEVFYTKNRNFCLPGVPWNMTVITSLQQELCPSFLLPSAPALGRCFPWTNVTPPALPGITNDTTIQQGISGLIDSLNARDISVKIFEDFAQSW
-
Molecular Weight
26.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC44A4, a member of the solute carrier (SLC) family, encodes a protein predominantly involved in the transport of various metabolites and ions, and has garnered significant interest in the fields of molecular biology and pharmacology. Its function in cellular processes includes the regulation of ion homeostasis and the modulation of neurotransmitter release, making it a key player in neuronal signaling and other physiological functions. Recent studies have highlighted its potential role in various diseases, including neurological disorders and metabolic syndromes, as altered expression levels of SLC44A4 have been correlated with pathophysiological conditions. The recombinant protein of SLC44A4 serves as an invaluable tool for elucidating its functional mechanisms and interactions within cells. By producing and studying this protein, researchers aim to better understand its structure-function relationships, identify potential substrates and inhibitors, and explore its therapeutic implications. Advances in recombinant DNA technology have facilitated the expression of SLC44A4 in various systems, enabling detailed physiological and biochemical characterization. As research progresses, SLC44A4 may emerge as a promising candidate for drug targeting, further underscoring the importance of studying its recombinant form in the context of health and disease.











