Analytical Data
-
Gene name
PSmg3
- Application
-
Alternative Names
PSMG3;C7orf48;PAC3;Proteasome assembly chaperone 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BT73
-
Expression Region
1-122aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMEDTPLVISKQKTEVVCGVPTQVVCTAFSS HILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAK NLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW
-
Molecular Weight
15 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PSmg3 is a recombinant protein derived from the protein-specific to the malaria parasite Plasmodium species, primarily focusing on its immune response elicitation properties. Research into PSmg3 is driven by the need for effective malaria vaccines and better understanding of the host-parasite interaction. Given that malaria continues to pose a significant public health challenge, with millions infected annually, harnessing the immune responses against such proteins could provide insights into vaccine development. The recombinant approach allows for the production of PSmg3 in a controlled environment, ensuring higher purity and activity levels compared to native protein extraction methods. Studies have revealed that PSmg3 can induce specific antibody responses, highlighting its potential as a candidate antigen for vaccine formulation. Furthermore, by investigating the structure-function relationship of PSmg3, researchers aim to identify epitopes that could enhance immunogenicity and enable cross-protection against various Plasmodium species. The exploration of PSmg3 not only contributes to the foundational understanding of malaria immunology but also represents a vital step towards the development of innovative therapeutic and preventive strategies in malaria control efforts.
