Cat: PA1000-2536

Recombinant Human Prss22 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Prss22

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PRSS22;BSSP4;PRSS26;Brain-specific serine protease 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9GZN4

  • Expression Region

    33-317aa

  • AA Sequence

    ARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTS RWVITAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRSQKVGVAWVEPHPVY SWKEGACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCWISGWGS IQDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPITEDMLCAGYLE GERDACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSAHR SWVEKIVQGVQLRGRAQGGGALRAPSQGSGAAARSHHHHHH

  • Molecular Weight

    32 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PRSS22, also known as serine protease 22, is a member of the serine protease family, which plays a critical role in a variety of biological processes, including inflammation, blood coagulation, and immune responses. The research surrounding PRSS22 has gained momentum due to its potential implications in various diseases, particularly in cancer and autoimmune disorders. Increased expression of PRSS22 has been observed in certain tumors, suggesting it may be involved in tumorigenesis and metastasis. This has spurred interest in characterizing the proteolytic activity of PRSS22 and understanding its substrate specificity. Additionally, investigations into the molecular mechanisms underlying its regulation and function could provide insights into its role in disease pathways. By studying recombinant PRSS22 proteins, researchers aim to elucidate its biochemical properties, interactions with other proteins, and potential as a therapeutic target. The production and purification of recombinant PRSS22 enable detailed functional assays and structural studies, which are critical for developing strategies to inhibit its activity in pathological conditions. Furthermore, understanding the role of PRSS22 in the context of the tumor microenvironment can lead to novel biomarkers for cancer diagnosis and prognosis, as well as new therapeutic approaches utilizing serine protease inhibitors. Overall, the research on PRSS22 is not only significant for basic biological understanding but also holds promise for translational applications in the field of medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US