Analytical Data
-
Gene name
GRE2
- Application
-
Alternative Names
GRE2；GrpE Protein homolog 2. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q12068
-
Expression Region
1-342aa
-
AA Sequence
MSVFVSGANGFIAQHIVDLLLKEDYKVIGSARSQEKAENLTEAFGNNPKFSMEVVPDISKLDAFDHVFQKHGKDIKIVLHTASPFCFDITDSERDLLIPAVNGVKGILHSIKKYAADSVERVVLTSSYAAVFDMAKENDKSLTFNEESWNPATWESCQSDPVNAYCGSKKFAEKAAWEFLEENRDSVKFELTAVNPVYVFGPQMFDKDVKKHLNTSCELVNSLMHLSPEDKIPELFGGYIDVRDVAKAHLVAFQKRETIGQRLIVSEARFTMQDVLDILNEDFPVLKGNIPVGKPGSGATHNTLGATLDNKKSKKLLGFKFRNLKETIDDTASQILKFEGRI
-
Molecular Weight
44.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of GRE2 recombinant protein primarily stems from its critical role in the response of organisms to stress, particularly in plants and some bacteria. GRE2, a member of the group of genes encoding proteins associated with stress and abiotic factors, is known to be involved in the synthesis of heat shock proteins and the regulation of cellular responses to temperature fluctuations and oxidative stress. Research into GRE2 has gained traction due to its potential applications in biotechnology and agriculture, where enhancing stress tolerance in crops could lead to improved yields and sustainability in the face of climate change. Furthermore, understanding the structural and functional properties of GRE2 recombinant protein can provide insights into the mechanisms of stress response, facilitating the development of genetically modified organisms with enhanced resilience. Advances in recombinant DNA technology have enabled the production, purification, and characterization of GRE2 protein, paving the way for detailed studies on its biochemical pathways and interactions. Consequently, the exploration of GRE2 recombinant protein not only contributes to the fundamental understanding of stress physiology in living organisms but also holds promise for practical applications in enhancing environmental stress tolerance in various plant species.
