Analytical Data
-
Gene name
CABP1
- Application
-
Alternative Names
CABP1；Calcium-binding Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P29377
-
Expression Region
1-79aa
-
AA Sequence
MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKNGDGEVSFEEFQVLVKKISQ
-
Molecular Weight
9.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CABP1 (Calcium Binding Protein 1) is a member of the calmodulin superfamily of calcium-binding proteins, playing a crucial role in calcium signaling and neuronal function. Its expression is predominantly found in the brain, suggesting a significant involvement in synaptic transmission and plasticity. Recent research has highlighted CABP1's potential influence on the modulation of ion channels, particularly in relation to voltage-gated calcium channels, which are vital for excitatory neurotransmitter release and muscle contraction. Mutations or dysregulation of CABP1 have been associated with various neurological disorders, including autism spectrum disorders and other neurodevelopmental conditions. The recombinant expression of CABP1 has thus become a focal point for understanding its biochemical properties and physiological roles. By producing CABP1 in a laboratory setting, researchers can study its structure-function relationships, elucidate its interactions with target proteins, and ultimately assess its impact on cellular signaling pathways. This research not only sheds light on the fundamental biology of calcium signaling but also opens avenues for therapeutic interventions targeting CABP1-related pathologies. Understanding CABP1's role in the nervous system could potentially lead to novel strategies for managing neurological diseases, highlighting the importance of this protein in both basic and applied research realms.
