Analytical Data
-
Gene name
Cd69
- Application
-
Alternative Names
Cd69；CLEC2C；Early activation antigen CD69
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q07108
-
Expression Region
62-199aa
-
AA Sequence
SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK
-
Molecular Weight
18.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD69 is an early activation marker expressed on the surface of various immune cells, including T and natural killer (NK) cells, upon their activation. It plays a crucial role in modulating immune responses, influencing cell proliferation, differentiation, and migration. Research into CD69 has gained momentum due to its involvement in autoimmune diseases, viral infections, and cancer. Its unique expression patterns and functional significance make CD69 a valuable target for therapeutic interventions. Recombinant CD69 protein is generated to study its structural and functional properties, understand its role in immune cell activation, and explore its potential as a biomarker or therapeutic target. The production of recombinant CD69 allows for more controlled experiments, facilitating in-depth analyses of its interactions with other immune modulators and receptors. Additionally, this research contributes to the development of novel immunotherapeutic strategies aimed at harnessing and regulating immune responses, with the potential to improve treatment outcomes for various diseases. Overall, the study of recombinant CD69 protein is essential for elucidating the complexities of the immune system and advancing immunological research.
