Cat: PA2000-909DB

Recombinant Human NR0B1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NR0B1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NR0B1;AHC;DAX1;Nuclear receptor subfamily 0 group B member 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P51843

  • Expression Region

    1-470aa

  • AA Sequence

    MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVG REGLLGGRNVALLYRCCFCGKDHPRQGSILYSMLTSAKQTYAAPKAPEAT LGPCWGCSCGSDPGVGRAGLPGGRPVALLYRCCFCGEDHPRQGSILYSLL TSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRATALLYRCC FCGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSSGALRPVALKS PQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELA QDRLQFETVEVSEPSMLQKILTTRRRETGGNEPLPVPTLQHHLAPPAEAR KVPSASQVQAIKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYI QGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFR PIIGTVSMDDMMLEMLCTKI

  • Molecular Weight

    78 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NR0B1, also known as DAX1 (Differentiation-Associated Factor 1), is a key transcription factor involved in various biological processes, including development, cell differentiation, and endocrine regulation. It is located on the X chromosome and plays a crucial role in the regulation of steroidogenesis and the development of the hypothalamic-pituitary-gonadal axis. Mutations or disruptions in NR0B1 are linked to several genetic disorders, notably Swyer syndrome, a condition characterized by XY individuals presenting with a female phenotype and gonadal dysgenesis. Research into NR0B1 recombinant protein has gained traction due to its potential implications in understanding gonadal development and function, as well as its role in certain endocrine disorders. Scientists have been focusing on the protein's structure, function, and interaction with other nuclear receptors to elucidate its mechanisms in gene regulation. By studying NR0B1 recombinant protein, researchers aim to develop targeted therapies for conditions arising from its dysfunction, providing insights into treatment options for affected individuals. Additionally, due to its involvement in key developmental processes, NR0B1 serves as a model for investigating transcriptional regulation and the intricate gene networks that govern sexual differentiation and reproductive health. This focus on NR0B1 not only enhances our understanding of human development and disease but also fosters the advancement of biotechnological applications in regenerative medicine and hormonal therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US