Cat: PA1000-2518

Recombinant Human PRND Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PRND

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PRND;DPL;Prion-like Protein doppel

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UKY0

  • Expression Region

    27-152aa

  • AA Sequence

    TRGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERG

  • Molecular Weight

    17 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PRND (Prion Protein Doppel) is a protein that has garnered significant attention in recent years due to its intriguing role in prion diseases and neurodegenerative conditions. Originally identified as a homologue of the prion protein (PrP), which is implicated in various transmissible spongiform encephalopathies (TSEs), PRND’s function remains less understood. Research has shown that PRND may possess neuroprotective properties and may modulate the pathogenic effects of PrP, suggesting a complex interaction between these proteins. Increased levels of PRND have been observed in certain neurodegenerative diseases, leading scientists to investigate its potential as a biomarker or therapeutic target. Studies have also explored the structural characteristics of PRND, uncovering its unique features compared to PrP, such as differences in glycosylation and folding patterns. Understanding the precise mechanisms by which PRND operates could shed light on its role in neurological health and disease, and might open new avenues for treatment strategies aimed at prion-related disorders. The exploration of PRND's interactions with other cellular proteins and its potential neuroprotective effects could provide important insights into the pathogenesis of neurodegeneration, ultimately fostering the development of novel therapeutic approaches. Hence, PRND is a significant focus of ongoing research, with the goal of elucidating its biological functions and therapeutic potential in the context of prion diseases and broader neurodegenerative processes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US