Analytical Data
-
Gene name
MRGPRF
- Application
-
Alternative Names
MRGPRF; GPR140; GPR168; MRGF; PSEC0142; Mas-related G-protein coupled receptor member F; Mas-related gene F protein; G-protein coupled receptor 140; G-protein coupled receptor 168
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96AM1
-
Expression Region
1-343 aa
-
AA Sequence
MAGNCSWEAHPGNRNKMCPGLSEAPELYSRGFLTIEQIAMLPPPAVMNYIFLLLCLCGLV GNGLVLWFFGFSIKRNPFSIYFLHLASADVGYLFSKAVFSILNTGGFLGTFADYIRSVCR VLGLCMFLTGVSLLPAVSAERCASVIFPAWYWRRRPKRLSAVVCALLWVLSLLVTCLHNY FCVFLGRGAPGAACRHMDIFLGILLFLLCCPLMVLPCLALILHVECRARRRQRSAKLNHV ILAMVSVFLVSSIYLGIDWFLFWVFQIPAPFPEYVTDLCICINSSAKPIVYFLAGRDKSQ RLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS
-
Molecular Weight
38.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MRGPRF (Mas-related G protein-coupled receptor F) is a member of the Mas-related GPCR family, which is primarily expressed in sensory neurons and plays a significant role in pain perception and inflammatory responses. Research on MRGPRF has gained traction due to its involvement in nociceptive pathways and its potential link to chronic pain conditions and itch sensation. Unlike classical GPCRs, MRGPRF is activated by a variety of endogenous and exogenous ligands, including neuropeptides and certain drugs, which makes it a unique target for therapeutic interventions. Increased expression of MRGPRF has been observed in models of inflammation and neuropathic pain, suggesting it may contribute to the sensitization of sensory neurons in these conditions. Understanding the molecular mechanisms underlying MRGPRF activation and signaling could pave the way for the development of novel analgesics and antipruritic agents. Consequently, the investigation of MRGPRF’s functions, signaling pathways, and interactions with ligands is crucial for elucidating its role in pain and itch modulation, providing insights that may lead to innovative treatments for related disorders. As the research continues to evolve, MRGPRF is becoming a promising target in the field of pain management, and efforts to characterize its biological functions at the molecular level are essential for harnessing its therapeutic potential.
