Analytical Data
-
Gene name
MPZL3
- Application
-
Alternative Names
MPZL3; UNQ2966/PRO7425; Myelin protein zero-like protein 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UWV2
-
Expression Region
1-235 aa
-
AA Sequence
MQQRGAAGSRGCALFPLLGVLFFQGVYIVFSLEIRADAHVRGYVGEKIKLKCTFKSTSDVTDKLTIDWTYRPPSSSHTVSIFHYQSFQYPTTAGTFRDRISWVGNVYKGDASISISNPTIKDNGTFSCAVKNPPDVHHNIPMTELTVTERGFGTMLSSVALLSILVFVPSAVVVALLLVRMGRKAAGLKKRSRSGYKKSSIEVSDDTDQEEEEACMARLCVRCAECLDSDYEETY
-
Molecular Weight
52.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MPZL3 (Myelin Protein Zero-Like 3) is a member of the immunoglobulin superfamily and is primarily expressed in the nervous system and certain immune cells. Its role in mediating cell adhesion and promoting interactions between immune cells and their microenvironment has garnered interest in recent years. The study of MPZL3 has been particularly relevant in understanding various neurological conditions, including multiple sclerosis and other autoimmune diseases, where its expression and function may be altered. Additionally, MPZL3 has been implicated in cancer biology, where it might influence tumor progression and the immune response to malignancies. The recombinant expression of MPZL3 protein allows researchers to investigate its structural and functional characteristics, elucidate its interaction with other proteins, and explore its potential as a biomarker or therapeutic target in disease settings. By producing MPZL3 as a recombinant protein, scientists aim to facilitate detailed studies on its biological roles, improve understanding of its mechanisms of action, and assess its potential applications in diagnostics and therapeutics. Overall, the research on MPZL3 and its recombinant protein forms holds promise for advancing our comprehension of both neurological and immunological processes.
