Analytical Data
-
Gene name
folA
- Application
-
Alternative Names
folA；dhfR；Dihydrofolate reductase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P99079
-
Expression Region
2-159aa
-
AA Sequence
TLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
-
Molecular Weight
25.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The folA gene encodes for dihydrofolate reductase (DHFR), an essential enzyme in the folate metabolism pathway, which plays a crucial role in the synthesis of nucleic acids. This enzyme catalyzes the reduction of dihydrofolate to tetrahydrofolate, a key cofactor involved in the production of nucleotides necessary for DNA and RNA synthesis. Given its vital function, folA has become an important target in antibiotic development, as inhibiting DHFR can effectively disrupt microbial growth. Studies have shown that mutations in the folA gene can lead to antibiotic resistance, complicating treatment strategies for bacterial infections. Additionally, the recombinant form of the folA protein has been utilized in various research applications, including studies on enzyme kinetics, inhibitor screening, and the development of new therapeutics. Understanding the structure and function of folA and its encoded protein not only advances our knowledge of microbial physiology but also aids in the design of novel drugs that combat resistance mechanisms in pathogens. Furthermore, folA's role in folate metabolism underscores its importance in various biological processes, making it a focal point in both clinical and biotechnological research.
