Analytical Data
-
Gene name
PRKAB2
- Application
-
Alternative Names
PRKAB2;5'-AMP-activated Protein kinase subunit beta-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43741
-
Expression Region
1-272aa
-
AA Sequence
MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
-
Molecular Weight
57.3kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRKAB2, or Protein Kinase AMP-Activated Non-Catalytic Subunit Beta 2, is a vital component of the AMP-activated protein kinase (AMPK) complex, which plays a crucial role in cellular energy homeostasis. The increasing prevalence of metabolic disorders, such as obesity and type 2 diabetes, has led to heightened interest in understanding the regulatory mechanisms of AMPK, as it helps monitor and respond to cellular energy levels. Research has indicated that PRKAB2, as a non-catalytic subunit, is involved in modulating AMPK activity in response to environmental stressors, thus impacting various physiological processes, including glucose uptake, lipid metabolism, and cell growth. Additionally, mutations or dysregulation in PRKAB2 have been associated with metabolic dysfunctions, making it a potential therapeutic target. Studies involving PRKAB2 recombinant proteins can provide insights into its structural and functional characteristics, elucidating its role in AMPK signaling pathways. The exploration of PRKAB2 not only enhances our understanding of energy regulation in cells but also opens avenues for developing novel strategies for treating metabolic diseases. This research emphasizes the significance of PRKAB2 in maintaining metabolic balance and its potential implications in therapeutic interventions for metabolic disorders, highlighting the relevance of recombinant protein studies in advancing our knowledge in this field.
