Analytical Data
-
Gene name
MPZL2
- Application
-
Alternative Names
MPZL2; EVA; EVA1; UNQ606/PRO1192; Myelin protein zero-like protein 2; Epithelial V-like antigen 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60487
-
Expression Region
1-215 aa
-
AA Sequence
MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRLSVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRKKRWAERAHKVVEIKSKEEERLNQEKKVSVYLEDTD
-
Molecular Weight
50.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MPZL2, or myelin protein zero-like 2, is a member of the immunoglobulin superfamily and has garnered attention due to its potential roles in cell adhesion, immune response, and various pathological conditions. Originally identified as a protein involved in myelination and neuronal interaction, studies have shown that MPZL2 plays a critical role in immune system regulation, influencing T cell activity and lymphocyte migration. Its expression patterns and molecular functions suggest that MPZL2 could be implicated in several diseases, including autoimmune disorders and tumors. Researchers are increasingly focused on elucidating the precise mechanisms by which MPZL2 mediates its effects on immune cells, as well as its interaction with other proteins within the immune signaling pathways. Given the growing evidence linking MPZL2 with both immune responses and neurological functions, the investigation of recombinant MPZL2 proteins has become crucial for understanding its biological roles, potential as a therapeutic target, and its involvement in disease states. Through these studies, researchers aim to develop strategies for modulating MPZL2 activity in clinical settings, potentially leading to innovative treatments for a range of immune-related diseases and enhancing our understanding of its role in the nervous system.
