Analytical Data
-
Gene name
PRH1
- Application
-
Alternative Names
PROP1;Homeobox Protein prophet of Pit-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02810
-
Expression Region
17-122aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSQDLNEDVSQEDVPLVISDGGDSEQFLD EERQGPPLGGQQSQPSAGDGNQDDGPQQGPPQQGGQQQQGPPPPQGKPQG PPQQGGHPPPPQGRPQGPPQQGGHPRPPR
-
Molecular Weight
13 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRH1 (Positive Regulatory Domain I-Binding Protein 1) is a member of the PRH/Hex family of transcription factors, which play essential roles in various biological processes, including cell differentiation, proliferation, and apoptosis. The study of PRH1 has gained attention due to its involvement in several diseases, particularly its regulatory functions in hematopoiesis and immune responses. Researchers have identified that PRH1 can modulate gene expression by interacting with other proteins and DNA elements, affecting cellular outcomes. Its dysregulation has been linked to disorders such as leukemia and other malignancies, highlighting its potential as a therapeutic target. To better understand PRH1's functions and mechanisms, scientists have focused on the development of recombinant PRH1 proteins. These recombinant proteins are crucial for elucidating PRH1’s structure-function relationships and its interactions with other cellular components. Utilizing techniques such as recombinant DNA technology, researchers can produce PRH1 in sufficient quantities for biochemical and biophysical analyses. This research not only enhances our understanding of PRH1's role in normal cellular physiology but also provides insights into its pathological implications, paving the way for the development of novel therapeutic strategies targeting PRH1 in related diseases. Overall, the study of PRH1 recombinant proteins represents a significant step forward in elucidating the complex regulatory networks involving this critical transcription factor.
