Cat: PA1000-2505

Recombinant Human PRH1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PRH1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PROP1;Homeobox Protein prophet of Pit-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P02810

  • Expression Region

    17-122aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSQDLNEDVSQEDVPLVISDGGDSEQFLD EERQGPPLGGQQSQPSAGDGNQDDGPQQGPPQQGGQQQQGPPPPQGKPQG PPQQGGHPPPPQGRPQGPPQQGGHPRPPR

  • Molecular Weight

    13 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PRH1 (Positive Regulatory Domain I-Binding Protein 1) is a member of the PRH/Hex family of transcription factors, which play essential roles in various biological processes, including cell differentiation, proliferation, and apoptosis. The study of PRH1 has gained attention due to its involvement in several diseases, particularly its regulatory functions in hematopoiesis and immune responses. Researchers have identified that PRH1 can modulate gene expression by interacting with other proteins and DNA elements, affecting cellular outcomes. Its dysregulation has been linked to disorders such as leukemia and other malignancies, highlighting its potential as a therapeutic target. To better understand PRH1's functions and mechanisms, scientists have focused on the development of recombinant PRH1 proteins. These recombinant proteins are crucial for elucidating PRH1’s structure-function relationships and its interactions with other cellular components. Utilizing techniques such as recombinant DNA technology, researchers can produce PRH1 in sufficient quantities for biochemical and biophysical analyses. This research not only enhances our understanding of PRH1's role in normal cellular physiology but also provides insights into its pathological implications, paving the way for the development of novel therapeutic strategies targeting PRH1 in related diseases. Overall, the study of PRH1 recombinant proteins represents a significant step forward in elucidating the complex regulatory networks involving this critical transcription factor.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US