Cat: PA2000-898DB

Recombinant Human ACOX3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ACOX3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ACOX3;BRCOX;PRCOX;Peroxisomal acyl-coenzyme A oxidase 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O15254

  • Expression Region

    1-624aa

  • AA Sequence

    MASTVEGGDTALLPEFPRGPLDAYRARASFSWKELALFTEGEGMLRFKKT IFSALENDPLFARSPGADLSLEKYRELNFLRCKRIFEYDFLSVEDMFKSP LKVPALIQCLGMYDSSLAAKYLLHSLVFGSAVYSSGSERHLTYIQKIFRM EIFGCFALTELSHGSNTKAIRTTAHYDPATEEFIIHSPDFEAAKFWVGNM GKTATHAVVFAKLCVPGDQCHGLHPFIVQIRDPKTLLPMPGVMVGDIGKK LGQNGLDNGFAMFHKVRVPRQSLLNRMGDVTPEGTYVSPFKDVRQRFGAS LGSLSSGRVSIVSLAILNLKLAVAIALRFSATRRQFGPTEEEEIPVLEYP MQQWRLLPYLAAVYALDHFSKSLFLDLVELQRGLASGDRSARQAELGREI HALASASKPLASWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTY EGDNNILLQQTSNYLLGLLAHQVHDGACFRSPLKSVDFLDAYPGILDQKF EVSSVADCLDSAVALAAYKWLVCYLLRETYQKLNQEKRSGSSDFEARNKC QVSHGRPLALAFVELTVVQRFHEHVHQPSVPPSLRAVLGRLSALYALWSL SRHAALLYRAERRCSCPGRRDRSS

  • Molecular Weight

    77.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ACOX3 (Acyl-CoA oxidase 3) is a crucial enzyme located within the peroxisomes, primarily involved in the fatty acid beta-oxidation process. Research surrounding ACOX3 has gathered significance due to its association with various biochemical pathways and its potential impact on metabolic disorders. Studies have revealed that ACOX3 plays an essential role in the metabolism of medium- and long-chain fatty acids, which are vital for energy production and cellular function. Mutations or deficiencies in the ACOX3 gene can lead to disorders such as X-Linked Adrenoleukodystrophy, characterized by the accumulation of toxic fatty acids, resulting in neurodegeneration and adrenal insufficiency. Furthermore, the enzyme’s activity is linked to inflammatory responses and oxidative stress, which are implicated in various diseases, including obesity and cardiovascular conditions. As a result, understanding the structure and function of the recombinant ACOX3 protein has become a focal point in biochemistry and molecular biology, paving the way for potential therapeutic interventions. The production and characterization of ACOX3 as a recombinant protein facilitate in-depth studies of its enzymatic functions, regulatory mechanisms, and interactions with other cellular components. This research not only enhances our understanding of ACOX3's role in metabolic pathways but also opens avenues for developing enzyme replacement therapies and exploring its potential as a biomarker for metabolic disorders. The growing interest in peroxisomal biogenesis and lipid metabolism highlights the need for continued research on ACOX3, promising exciting developments in the fields of medical and translational research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US