Cat: PA1000-2503

Recombinant MACFA TTR Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TTR

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TTR;PALB;Transthyretin

  • Species

    MACFA

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8HXW1

  • Expression Region

    21-147aa

  • AA Sequence

    GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTS ESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDS GPRHYTIAALLSPYSYSTTAVVTNPKE

  • Molecular Weight

    15 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Transferrin receptor (TTR) is an important protein involved in the transport of retinol and thyroxine, primarily synthesized in the liver and the choroid plexus of the brain. Recent studies have highlighted its role in various pathological conditions, including neurodegenerative diseases, amyloidosis, and metabolic disorders. TTR itself can misfold and aggregate, leading to the formation of amyloid deposits that can severely compromise organ function. This has spurred research into TTR as a potential therapeutic target, as well as a candidate for recombinant protein studies. Understanding the molecular mechanisms of TTR misfolding and aggregation is essential for developing effective treatments. Recombinant proteins, particularly engineered variants of TTR, are being explored for their ability to stabilize its structure and inhibit amyloid formation. Furthermore, advancements in recombinant DNA technology have enabled the production of various TTR isoforms with specific modifications that could enhance their therapeutic potential. The investigation of TTR recombinant proteins is thus critical, not only for elucidating TTR’s biological functions but also for developing practical applications in drug design and therapeutic interventions for diseases associated with TTR dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US