Analytical Data
-
Gene name
PRDX2
- Application
-
Alternative Names
PRDX2;NKEFB;TDPX1;Peroxiredoxin-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P32119
-
Expression Region
2-198aa
-
AA Sequence
ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
-
Molecular Weight
25.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRDX2 (Peroxiredoxin 2) is a member of the peroxiredoxin family of antioxidant enzymes, which play a crucial role in cellular redox regulation and protection against oxidative stress. This protein is primarily located in the cytoplasm and is known for its ability to reduce reactive oxygen species (ROS), thereby minimizing cellular damage. Research has shown that PRDX2 is involved in various biological processes, including cell proliferation, apoptosis, and inflammation. Dysregulation of PRDX2 has been linked to several diseases, including cancer, neurodegenerative disorders, and cardiovascular diseases, highlighting its potential as a therapeutic target. The recombinant expression of PRDX2 protein has become an important tool for studying its structure-function relationships and its role in cellular processes. By producing PRDX2 in a controlled environment, researchers can investigate its enzymatic activities, explore potential posttranslational modifications, and assess its interactions with other biomolecules. Understanding PRDX2's molecular mechanisms may yield insights into its protective functions and pave the way for innovative strategies in disease prevention and treatment. Furthermore, the recombinant PRDX2 can be used in developing biosensors or therapeutic agents that harness its antioxidant properties. Overall, the study of recombinant PRDX2 is a rapidly evolving field with significant implications for understanding cellular homeostasis and developing novel therapeutic interventions.
