Analytical Data
-
Gene name
MPHOSPH1
- Application
-
Alternative Names
Cancer/testis antigen 90; CT90; KI20B_HUMAN; KIF20B; Kinesin-like protein KIF20B; Kinesin-related motor interacting with PIN1; KRMP1; M-phase phosphoprotein 1; MPHOSPH1; MPP 1; Mpp1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96Q89
-
Expression Region
1671-1780 aa
-
AA Sequence
RSQASIIGVNLATKKKEGTLQKFGDFLQHSPSILQSKAKKIIETMSSSKLSNVEASKENVSQPKRAKRKLYTSEISSPIDISGQVILMDQKMKESDHQIIKRRLRTKTAK
-
Molecular Weight
37.84 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MPHOSPH1 (M-phase phosphoprotein 1) is a member of the M-phase phosphoprotein family, which is involved in the regulation of cell cycle progression and mitosis. Research has shown that MPHOSPH1 plays a crucial role in the phosphorylation of specific substrates that are essential for cell division and proper mitotic function. Dysregulation of this protein has been implicated in various cancers, where its aberrant expression may contribute to uncontrolled cell proliferation. Furthermore, studies have highlighted its potential as a biomarker for cancer diagnosis and prognosis. The recombinant expression of MPHOSPH1 is vital for elucidating its functional mechanisms and understanding its interactions with cellular pathways. By producing and purifying this protein, researchers aim to perform biochemical assays, structural studies, and functional analyses to gain insights into its role in oncogenesis and possible therapeutic targets. Given the rising interest in the development of targeted cancer therapies, the investigation of MPHOSPH1 and its associated pathways represents a promising area of research that could lead to novel treatment options for cancer patients.
