Analytical Data
-
Gene name
PTER
- Application
-
Alternative Names
PTER；Phosphotriesterase-related Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96BW5
-
Expression Region
1-349aa
-
AA Sequence
MSSLSGKVQTVLGLVEPSKLGRTLTHEHLAMTFDCCYCPPPPCQEAISKEPIVMKNLYWIQKNAYSHKENLQLNQETEAIKEELLYFKANGGGALVENTTTGISRDTQTLKRLAEETGVHIISGAGFYVDATHSSETRAMSVEQLTDVLMNEILHGADGTSIKCGIIGEIGCSWPLTESERKVLQATAHAQAQLGCPVIIHPGRSSRAPFQIIRILQEAGADISKTVMSHLDRTILDKKELLEFAQLGCYLEYDLFGTELLHYQLGPDIDMPDDNKRIRRVRLLVEEGCEDRILVAHDIHTKTRLMKYGGHGYSHILTNVVPKMLLRGITENVLDKILIENPKQWLTFK
-
Molecular Weight
39KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTER (Pseudomonas syringae type III effector protein) is a significant protein of interest in plant-microbe interactions, particularly due to its role in the virulence of pathogenic bacteria that infect plants. Understanding PTER's structure and function is crucial, as it can manipulate host plant immune responses, facilitating bacterial infection and disease development. The study of PTER and other type III effectors provides insights into the molecular mechanisms underlying plant immunity and pathogen strategies to overcome these defenses. With increasing concerns over food security and agricultural sustainability, research on PTER also has implications for developing disease-resistant crop varieties and improving plant resilience against microbial pathogens. Furthermore, advanced techniques such as CRISPR/Cas9 and proteomics are being utilized to dissect the pathways influenced by PTER, offering potential targets for biotechnological applications in crop protection and management. As a result, PTER research not only enhances our fundamental understanding of plant-pathogen interactions but also contributes to practical solutions in agriculture, highlighting its importance in both basic and applied biological sciences.
