Analytical Data
-
Gene name
PPP3R1
- Application
-
Alternative Names
PPP3R1;CNA2;CNB;Calcineurin subunit B type 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P63098
-
Expression Region
1-170aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGNEASYPLEMCSHFDADEIKRLGKRFKKL DLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVS QFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPP3R1, also known as the Regulatory Subunit of Protein Phosphatase 2B, plays a crucial role in various cellular processes, including calcium signaling, immune responses, and neuronal function. Its dysregulation has been implicated in several pathologies, such as cancer, neurodegenerative diseases, and cardiovascular disorders. Researchers have focused on the structural and functional characterization of PPP3R1 to better understand its role in health and disease. By studying its interactions with other proteins and signaling pathways, scientists aim to elucidate the molecular mechanisms underlying its diverse biological functions. Additionally, the development of PPP3R1 recombinant proteins offers valuable tools for investigating its role in different contexts and may lead to therapeutic prospects. Understanding the intricate balance of PPP3R1 activity could pave the way for novel interventions in diseases where this protein is implicated, highlighting its importance in both basic research and clinical applications.
