Analytical Data
-
Gene name
PPP1CC
- Application
-
Alternative Names
PPP1CC;Serine/threonine-Protein phosphatase PP1-gamma catalytic subunit
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P36873
-
Expression Region
1-323aa
-
AA Sequence
MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQP ILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQS LETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWK TFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGL LCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQV VEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE KKKPNATRPVTPPRGMITKQAKK
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPP1CC, or Protein Phosphatase 1 Catalytic Subunit gamma, is a critical enzyme involved in various cellular processes, including cell cycle regulation, glycogen metabolism, and signal transduction. As a member of the protein phosphatase 1 (PP1) family, PPP1CC plays a vital role in dephosphorylating serine and threonine residues on target proteins, thus modulating their activity, localization, and interactions. The study of PPP1CC and its recombinant protein has significant implications in understanding its function in health and disease. Alterations in PPP1CC activity have been linked to several pathological conditions, including cancer, neurodegenerative diseases, and cardiovascular disorders, highlighting its potential as a therapeutic target. Researchers aim to elucidate the structural and functional characteristics of the PPP1CC recombinant protein, which can aid in the development of specific inhibitors or modulators that can fine-tune its activity. Such studies also pave the way for investigating PPP1CC's interactions with various regulatory subunits and cofactors, offering insights into its versatile role in cellular signaling networks. Overall, the research on PPP1CC recombinant protein not only enhances our understanding of fundamental biological processes but also opens new avenues for drug discovery and therapeutic interventions.











