Cat: PA2000-5187

Recombinant Human Syt2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Syt2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Syt2;Synaptotagmin-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8N9I0

  • Expression Region

    1-419aa

  • AA Sequence

    MRNIFKRNQEPIVAPATTTATMPIGPVDNSTESGGAGESQEDMFAKLKEKLFNEINKIPLPPWALIAIAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK

  • Molecular Weight

    46.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Syt2 (Synaptotagmin 2) is a member of the synaptotagmin family of proteins, which play crucial roles in calcium-dependent exocytosis and neurotransmitter release in neurons. Research on Syt2 has garnered significant interest due to its pivotal function in synaptic transmission and its potential implications in understanding various neurological disorders. Syt2 binds calcium ions and facilitates the fusion of synaptic vesicles with the plasma membrane, thereby mediating the rapid release of neurotransmitters. While the fundamental role of Syt2 in neurotransmission has been established, the specific mechanisms of its interactions with other proteins and its regulatory pathways are still not fully understood. Recent advances in structural biology, including cryo-electron microscopy and X-ray crystallography, have provided insights into its functional domains and conformational changes upon calcium binding. Additionally, studies have linked dysregulation of Syt2 to conditions such as autism spectrum disorders and certain forms of epilepsy, highlighting the necessity of delineating its molecular mechanisms. The recombinant expression of Syt2 protein enables detailed biochemical characterization and functional assays, which are essential for elucidating its role in synaptic function. This research not only contributes to foundational knowledge in neurobiology but also holds promise for therapeutic strategies targeting synaptic dysfunctions associated with neurological diseases. Understanding Syt2's molecular dynamics and interactions could pave the way for innovative approaches in treating synaptic impairment, making it a focal point of contemporary neuroscience research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US