Analytical Data
-
Gene name
MOGAT3
- Application
-
Alternative Names
MOGAT3; DC7; DGAT2L7; UNQ9383/PRO34208; 2-acylglycerol O-acyltransferase 3; Acyl-CoA:monoacylglycerol acyltransferase 3; MGAT3; Diacylglycerol O-acyltransferase candidate 7; hDC7; Diacylglycerol acyltransferase 2-like protein 7; Monoacylglycerol O-acyltransferase 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86VF5
-
Expression Region
1-341 aa
-
AA Sequence
MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLFMGPFFSLLVFVLLFTSLWPFSVFYL VWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDRNYVLGAHPHGIMC TGFLCNFSTESNGFSQLFPGLRPWLAVLAGLFYLPVYRDYIMSFGLCPVSRQSLDFILSQ PQLGQAVVIMVGGAHEALYSVPGEHCLTLQKRKGFVRLALRHGASLVPVYSFGENDIFRL KAFATGSWQHWCQLTFKKLMGFSPCIFWGRGLFSATSWGLLPFAVPITTVVGRPIPVPQR LHPTEEEVNHYHALYMTALEQLFEEHKESCGVPASTCLTFI
-
Molecular Weight
38.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MOGAT3 (monoacylglycerol O-acyltransferase 3) is an important enzyme involved in lipid metabolism, specifically in the synthesis of diacylglycerol (DAG) from monoacylglycerols. Research on MOGAT3 has gained traction due to its potential implications in metabolic disorders, obesity, and cardiovascular diseases. As a critical player in the endocannabinoid system, MOGAT3 regulates the levels of 2-arachidonoylglycerol (2-AG), a lipid mediator with roles in neuronal signaling and inflammation. Increased MOGAT3 activity has been linked to heightened 2-AG levels, which can influence various physiological processes and contribute to the pathogenesis of several conditions, including diabetes and neurodegenerative diseases. The exploration of MOGAT3 as a therapeutic target is of great interest, as modulating its activity may offer new avenues for treatment. The development of recombinant MOGAT3 proteins allows for in-depth biochemical studies, enabling researchers to characterize its enzymatic properties and substrate specificity. Additionally, understanding the structure-function relationship of MOGAT3 through recombinant techniques can aid in the design of selective inhibitors, potentially leading to novel strategies for managing metabolic diseases. Overall, the study of MOGAT3 not only enhances our understanding of lipid metabolism but also opens potential therapeutic interventions for challenging health issues related to metabolic dysfunctions.











