Cat: PA1000-2464

Recombinant Human POMC Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    POMC

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    POMC;Pro-opiomelanocortin

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P01189

  • Expression Region

    27-267aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMWCLESSQCQDLTTESNLLECIRACKPDLS AETPMFPGNGDEQPLTENPRKYVMGHFRWDRFGRRNSSSSGSSGAGQKRE DVSAGEDCGPLPEGGPEPRSDGAKPGPREGKRSYSMEHFRWGKPVGKKRR PVKVYPNGAEDESAEAFPLEFKRELTGQRLREGDGPDGPADDGAGAQADL EHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFK NAIIKNAYKKGE

  • Molecular Weight

    29 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Pro-opiomelanocortin (POMC) is a precursor polypeptide with significant roles in various physiological processes, including appetite regulation, stress response, and pigmentation. POMC is primarily expressed in the pituitary gland and is cleaved into several biologically active peptides, such as adrenocorticotropic hormone (ACTH) and melanocyte-stimulating hormones (MSHs). Research into POMC recombinant proteins has gained traction due to their potential therapeutic implications in treating obesity, metabolic disorders, and adrenal insufficiencies. Given POMC's crucial role in energy homeostasis, alterations in its signaling pathways are linked to obesity and other metabolic diseases. Recombinant POMC proteins can be utilized in studies to understand the mechanisms of action at the molecular level, as well as to develop novel strategies for targeted drug delivery and therapeutic interventions. Furthermore, advances in genetic engineering techniques have allowed for the creation of modified POMC variants, enhancing the specificity and efficacy of peptide-based therapies. Overall, the investigation of POMC recombinant proteins contributes to a deeper understanding of their biological functions and holds promise for clinical applications in managing metabolic disorders and related conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US