Cat: PA1000-2455

Recombinant Human POLR3F Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    POLR3F

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    POLR3F;DNA-directed RNA polymerase III subunit RPC6

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H1D9

  • Expression Region

    1-316aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMAEVKVKVQPPDADPVEIENRIIELCH QFPHGITDQVIQNEMPHIEAQQRAVAINRLLSMGQLDLLRSNTGLLYRIK DSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDIRYKSNLPLTEINKIL KNLESKKLIKAVKSVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFV EVLNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISK VELSMEDIETILNTLIYDGKVEMTIIAAKEGTVGSVDGHMKLYRAVNPII PPTGLVRAPCGLCPVFDDCHEGGEISPSNCIYMTEWLEF

  • Molecular Weight

    38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

POLR3F, also known as polymerase (RNA) III polypeptide F, is a crucial component of the RNA polymerase III (Pol III) complex, which is responsible for synthesizing various small RNA molecules, including transfer RNA (tRNA), ribosomal RNA (rRNA), and small nuclear RNA (snRNA). The proper functioning of Pol III is essential for maintaining normal cellular processes such as protein synthesis, gene expression regulation, and the overall integrity of the transcriptome. Mutations or dysregulation of POLR3F have been implicated in several pathological conditions, including neurodevelopmental disorders and certain cancers. Research into POLR3F recombinant proteins aims to elucidate its structural and functional properties, enabling a deeper understanding of the Pol III transcription machinery. By producing recombinant POLR3F, scientists can investigate its interactions with other Pol III subunits and regulatory factors, as well as its role in the transcriptional process. Furthermore, understanding POLR3F's mechanism could pave the way for potential therapeutic strategies targeting related diseases. Thus, the study of POLR3F recombinant proteins represents a significant step toward comprehensively understanding Pol III function and its implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US