Analytical Data
-
Gene name
TAS2R10
- Application
-
Alternative Names
TAS2R10；Taste receptor type 2 member 10
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NYW0
-
Expression Region
64-100aa
-
AA Sequence
DGFIQIFSPNIYASGNLIEYISYFWVIGNQSSMWFAT
-
Molecular Weight
19.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TAS2R10 is a member of the taste receptor family involved in bitter taste perception, which plays a critical role in the evolutionary adaptation of organisms by helping them identify potentially harmful substances. Research on TAS2R10 has garnered attention due to its implications in food preferences, dietary choices, and health outcomes. The receptor is known to respond to a variety of bitter compounds, and its signaling pathways are essential for the perception of bitterness, which can influence behaviors related to feeding and toxin avoidance. Recent studies have focused on the recombinant expression of TAS2R10 in heterologous systems, allowing for detailed biochemical characterization and functional assays of the receptor. This enables researchers to explore its ligand-binding properties and downstream signaling mechanisms, which can provide insights into how bitter taste perception affects nutritional habits and health. Additionally, understanding TAS2R10's role in taste signaling may contribute to the development of novel food products aimed at enhancing flavor while promoting healthier dietary choices. Overall, the investigation of TAS2R10 serves as a pivotal point in bridging taste biology with nutritional science, emphasizing the importance of taste receptors in shaping human behavior and health.
