Cat: PA1000-2432

Recombinant Human PNMT Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PNMT

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PNMT;PENT;Phenylethanolamine N-methyltransferase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P11086

  • Expression Region

    1-282aa

  • AA Sequence

    MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNP NGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMT DFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRAR VKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDH ITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKV RDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL

  • Molecular Weight

    57 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PNMT, or phenylethanolamine N-methyltransferase, is an important enzyme involved in the biosynthesis of catecholamines, specifically norepinephrine and epinephrine from phenylethanolamine substrates. This enzyme is predominantly expressed in the adrenal medulla and is critical for the regulation of the stress response, cardiovascular function, and metabolic processes. Understanding the function and regulation of PNMT is crucial because dysregulation can lead to various health issues, including hypertension and anxiety disorders. In recent years, research has focused on the recombinant expression of PNMT to study its enzymatic properties, structure-function relationships, and interaction with substrates in detail. Recombinant PNMT provides a valuable tool for investigating the enzymatic mechanisms and for screening potential inhibitors that could lead to therapeutic applications. Through techniques such as site-directed mutagenesis and crystallography, researchers aim to elucidate the active site architecture and define the biochemical pathways involving this enzyme. The growing knowledge about PNMT contributes to a better understanding of catecholamine-related diseases and potentially paves the way for novel treatment strategies targeting the adrenergic system.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US