Analytical Data
-
Gene name
PNMT
- Application
-
Alternative Names
PNMT;PENT;Phenylethanolamine N-methyltransferase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11086
-
Expression Region
1-282aa
-
AA Sequence
MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNP NGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMT DFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRAR VKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDH ITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKV RDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL
-
Molecular Weight
57 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PNMT, or phenylethanolamine N-methyltransferase, is an important enzyme involved in the biosynthesis of catecholamines, specifically norepinephrine and epinephrine from phenylethanolamine substrates. This enzyme is predominantly expressed in the adrenal medulla and is critical for the regulation of the stress response, cardiovascular function, and metabolic processes. Understanding the function and regulation of PNMT is crucial because dysregulation can lead to various health issues, including hypertension and anxiety disorders. In recent years, research has focused on the recombinant expression of PNMT to study its enzymatic properties, structure-function relationships, and interaction with substrates in detail. Recombinant PNMT provides a valuable tool for investigating the enzymatic mechanisms and for screening potential inhibitors that could lead to therapeutic applications. Through techniques such as site-directed mutagenesis and crystallography, researchers aim to elucidate the active site architecture and define the biochemical pathways involving this enzyme. The growing knowledge about PNMT contributes to a better understanding of catecholamine-related diseases and potentially paves the way for novel treatment strategies targeting the adrenergic system.











