Analytical Data
-
Gene name
GPBAR1
- Application
-
Alternative Names
GPBAR1；TGR5；G-Protein coupled bile acid receptor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TDU6
-
Expression Region
1-330aa
-
AA Sequence
MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN
-
Molecular Weight
36.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPBAR1, also known as TGR5, is a G protein-coupled receptor primarily expressed in the gastrointestinal tract, immune cells, and brown adipose tissue. It plays a crucial role in metabolic regulation, bile acid signaling, and energy homeostasis. The receptor is activated by bile acids, which modulate various physiological processes, including glucose metabolism, insulin secretion, and inflammation. Given the rising incidence of metabolic disorders such as obesity and type 2 diabetes, GPBAR1 has gained significant attention as a potential therapeutic target. The development of recombinant GPBAR1 proteins is essential for elucidating the receptor's structure-function relationships and biochemical pathways. By generating and studying these recombinant proteins, researchers aim to better understand GPBAR1's role in metabolic diseases and explore its potential as a target for novel pharmacological interventions. This approach can yield insights into the receptor's activation mechanisms, downstream signaling cascades, and interaction with small molecules, paving the way for developing GPBAR1 modulators that can improve metabolic health and provide new treatment options for related disorders.
