Analytical Data
-
Gene name
UBALD2
- Application
-
Alternative Names
UBALD2；FAM100B；UBA-like domain-containing Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IYN6
-
Expression Region
2-164aa
-
AA Sequence
SVNMDELRHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSTFFQETNIPNSHHHHQMMCTPSNTPATPPNFPDALAMFSKLRASEGLQSSNSPMTAAACSPPANFSPFWASSPPSHQAPWIPPSSPTTFHHLHRPQPTWPPGAQQGGAQQKAMAAMDGQR
-
Molecular Weight
25.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UBALD2 (Ubiquitin-like domain containing protein 2) is a member of the ubiquitin-like protein family and has gained significance in recent research due to its potential role in various cellular processes. The protein is thought to be involved in the regulation of protein turnover, stress responses, and cellular signaling pathways. Recent studies have indicated that UBALD2 may play a critical role in modulating immune responses and has been implicated in cancer progression. Researchers are particularly interested in understanding its structural characteristics and functional mechanisms, especially how UBALD2 interacts with other proteins and cellular machinery. The utilization of recombinant DNA technology to produce UBALD2 in a controlled laboratory setting has made it possible to explore these interactions and its biological functions in greater depth. By generating recombinant UBALD2 protein, scientists aim to elucidate its role in pathophysiological conditions, marking it as a potential therapeutic target. Furthermore, the impact of post-translational modifications on UBALD2’s functionality is another area of ongoing investigation. Overall, the study of UBALD2 is essential for advancing our understanding of cellular dynamics and developing novel therapeutic approaches for diseases where its activity is found to be dysregulated.
