Analytical Data
-
Gene name
PMM1
- Application
-
Alternative Names
PMM1;PMMH22;Phosphomannomutase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92871
-
Expression Region
1-262aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAVTAQAARRKERVLCLFDVDGTLTPARQK IDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAEN GTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIE FRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLR FSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIF ADPRTVGHSVVSPQDTVQRCREIFFPETAHEA
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PMM1 (Phosphomannomutase 1) is an enzyme that plays a crucial role in the mannose biosynthetic pathway, which is pivotal for proper protein glycosylation. This protein is primarily expressed in the cytoplasm and is responsible for converting mannose-6-phosphate to mannose-1-phosphate, a key precursor for the synthesis of GDP-mannose, an essential sugar nucleotide in the formation of glycoproteins and glycolipids. Mutations in the PMM1 gene are associated with congenital disorders of glycosylation (CDG), a group of genetic conditions that can lead to severe neurological and developmental issues, highlighting the clinical importance of understanding PMM1 function and regulation. Consequently, research on recombinant PMM1 protein has gained momentum as scientists seek to elucidate its structure-function relationship, enzymatic mechanisms, and potential therapeutic applications. Techniques such as molecular cloning, expression in heterologous systems, and biochemical characterization have been employed to produce and study PMM1, allowing researchers to analyze its catalytic activity and interactions with various substrates. By advancing our knowledge of PMM1, scientists aim to develop novel strategies for diagnosing and treating PMM1-related disorders, ultimately contributing to improved outcomes for affected individuals and enhancing our understanding of the broader implications of glycosylation in health and disease.











